DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Imp and Pcbp3

DIOPT Version :9

Sequence 1:NP_001245616.1 Gene:Imp / 32009 FlyBaseID:FBgn0285926 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_038954494.1 Gene:Pcbp3 / 294336 RGDID:1307430 Length:402 Species:Rattus norvegicus


Alignment Length:371 Identity:92/371 - (24%)
Similarity:159/371 - (42%) Gaps:81/371 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GRQADFPLRILVQSEMVGAIIGRQGSTIRTITQQSRARVDVHRKENVGSL-EKSITIYGNPENCT 201
            |......:|:|:..:.||:|||::|.|::.:.::|.||:::    :.|:. |:.:||.|..:...
  Rat    41 GLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINI----SEGNCPERIVTITGPTDAIF 101

  Fly   202 NACKRILEVMQQEAISTNKGELSPECSE--ICLKILAHNNLIGRIIGKSGNTIKRIMQDTDTKIT 264
            .|...|....:::.|  |....||..|:  :.|:::...:..|.:|||.|:.||.|.:.|..::.
  Rat   102 KAFAMIAYKFEED
II--NSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQ 164

  Fly   265 VSSINDINSFNLERIITVKGLIENMSRAENQISTKLRQS--------YENDLQAMAPQSLMFPG- 320
            |:  .|:...:.||.:|:.|..:.:.:...||...:.:|        |.   ...|...::|.| 
  Rat   165 VA--GDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYR---PKPASTPVIFAGG 224

  Fly   321 ---LHPMAMMST-----------PGNGMVFNTSMPFP--SCQSF----------AMSKT---PAS 356
               ..|:|..:.           |...:....::|.|  ||.|:          ||.:|   |..
  Rat   225 QVRADPLAASTANLSLLLQHPPLPAYTIQGQYAIPHPDLSCPSYPQQLTKLHQLAMQQTPFPPLG 289

  Fly   357 VVPPVFPNDL------------------------QETTYLYIPNNAVGAIIGTRGSHIRSIMRFS 397
            ...|.||.:.                        ..|..|.|||:.:|.|||.:|:.|..|.:.|
  Rat   290 QTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMS 354

  Fly   398 NASLKIAPLDADKPLDQQTERKVTIVGTPEGQWKAQYMIFEKMREE 443
            .|.:|||     ...:..:||::||.|||.....|||:|..::..|
  Rat   355 GAQIKIA-----NATEGSSERQITITGTPANISLAQYLINARLTSE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpNP_001245616.1 RRM <37..>146 CDD:223796 1/7 (14%)
RRM2_VICKZ 42..118 CDD:240805
KH-I 145..208 CDD:238053 18/63 (29%)
KH-I 232..296 CDD:238053 16/63 (25%)
KH-I 369..436 CDD:238053 27/66 (41%)
KH-I 455..522 CDD:238053
Pcbp3XP_038954494.1 KH-I_PCBP3_rpt1 38..114 CDD:411944 20/76 (26%)
KH-I_PCBP3_rpt2 125..203 CDD:411947 20/79 (25%)
KH-I_PCBP3_rpt3 317..391 CDD:411950 28/78 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.