DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Imp and LOC108190446

DIOPT Version :9

Sequence 1:NP_001245616.1 Gene:Imp / 32009 FlyBaseID:FBgn0285926 Length:638 Species:Drosophila melanogaster
Sequence 2:XP_021333022.1 Gene:LOC108190446 / 108190446 -ID:- Length:105 Species:Danio rerio


Alignment Length:87 Identity:29/87 - (33%)
Similarity:45/87 - (51%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 TTYLYIPNNAVGAIIGTRGSHIRSIMRFSNASLKIAPLDADKPLDQQTERKVTIVGTPEGQWKAQ 433
            |.|..:    :|.|||.:|:.|..|.:.|.|.:||     |..::..::|::||.|||.....||
Zfish    27 TLYFQL----IGCIIGRQGTKINEIRQMSGAQIKI-----DNAMEGSSDRQITITGTPAIISLAQ 82

  Fly   434 YMIFEKMREEGFMCGTDDVRLT 455
            |:|..:.|:...| .||...:|
Zfish    83 YLINARFRDVAAM-WTDPSTMT 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpNP_001245616.1 RRM <37..>146 CDD:223796
RRM2_VICKZ 42..118 CDD:240805
KH-I 145..208 CDD:238053
KH-I 232..296 CDD:238053
KH-I 369..436 CDD:238053 23/66 (35%)
KH-I 455..522 CDD:238053 1/1 (100%)
LOC108190446XP_021333022.1 KH-I 31..85 CDD:238053 21/62 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D286875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.