DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and PM-ANT

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_200456.1 Gene:PM-ANT / 835746 AraportID:AT5G56450 Length:330 Species:Arabidopsis thaliana


Alignment Length:300 Identity:133/300 - (44%)
Similarity:187/300 - (62%) Gaps:10/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQ------RYKGIVDCFIRIPK 73
            ||.|..|.:.|.|...:..|.||||||.||:||.||.:..|..|:      |:||:.|...|..:
plant    27 LKHFQKDLLAGAVMGGVVHTIVAPIERAKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRTVR 91

  Fly    74 EQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSL 138
            |:|..|.||||.::|:||:|:.||||:.||:|:|:......:....:.....|..:|.|||.|:|
plant    92 EEGVLSLWRGNGSSVLRYYPSVALNFSLKDLYRSILRNSSSQENHIFSGALANFMAGSAAGCTAL 156

  Fly   139 CFVYPLDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGF 203
            ..|||||.|.||||||:||...|:|.|:...|..:.|.||..|:|||...|:.|::|:|..|||.
plant   157 IVVYPLDIAHTRLAADIGKPEARQFRGIHHFLSTIHKKDGVRGIYRGLPASLHGVIIHRGLYFGG 221

  Fly   204 YDTCRD-FLPNPK-STPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHC 266
            :||.:: |..:.| ....:..|.:||.|||.||:||||.||||||:|||||::  ..:|::|..|
plant   222 FDTVKEIFSEDTKPELALWKRWGLAQAVTTSAGLASYPLDTVRRRIMMQSGME--HPMYRSTLDC 284

  Fly   267 WLVIAKQEGIGAFFKGALSNIIRGTGGALVLALYDEMKKY 306
            |..|.:.||:.:|::|||||:.|.||.|.:|..|||:|::
plant   285 WKKIYRSEGLASFYRGALSNMFRSTGSAAILVFYDEVKRF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 132/297 (44%)
Mito_carr 17..111 CDD:278578 43/99 (43%)
Mito_carr 119..215 CDD:278578 42/96 (44%)
Mito_carr 218..307 CDD:278578 45/88 (51%)
PM-ANTNP_200456.1 PTZ00169 27..325 CDD:240302 133/299 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2331
eggNOG 1 0.900 - - E1_KOG0749
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54049
OrthoDB 1 1.010 - - D870903at2759
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100505
Panther 1 1.100 - - O PTHR45635
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.790

Return to query results.
Submit another query.