DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and slc25a6

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001122204.1 Gene:slc25a6 / 566370 ZFINID:ZDB-GENE-070912-446 Length:298 Species:Danio rerio


Alignment Length:291 Identity:221/291 - (75%)
Similarity:248/291 - (85%) Gaps:1/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFW 81
            ||..||:.|||:|||:||||||||||||:||||..||||:||::|||||||.:||||||||:|||
Zfish     7 SFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISADKQYKGIVDCIVRIPKEQGFASFW 71

  Fly    82 RGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDF 146
            ||||||||||||||||||||||.||.:||||||||.||||:||||||||||||||||||||||||
Zfish    72 RGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDF 136

  Fly   147 ARTRLAADVGKGGN-REFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDF 210
            |||||||||||.|: |||:||.|||.|:.||||..|||:||.||||||:||||||||.|||.:..
Zfish   137 ARTRLAADVGKAGSTREFSGLADCLAKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGM 201

  Fly   211 LPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEG 275
            ||:||:|...|||.|||.||.|||:.||||||||||||||||.|.::::|..|..||..||:.||
Zfish   202 LPDPKNTHIMVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTLDCWRKIARDEG 266

  Fly   276 IGAFFKGALSNIIRGTGGALVLALYDEMKKY 306
            ..|||||||||::||.|||.||.||||.|||
Zfish   267 SKAFFKGALSNVLRGMGGAFVLVLYDEFKKY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 218/288 (76%)
Mito_carr 17..111 CDD:278578 75/93 (81%)
Mito_carr 119..215 CDD:278578 76/96 (79%)
Mito_carr 218..307 CDD:278578 59/89 (66%)
slc25a6NP_001122204.1 PTZ00169 7..298 CDD:240302 221/291 (76%)
Mito_carr 7..101 CDD:278578 75/93 (81%)
Mito_carr 109..206 CDD:278578 76/96 (79%)
Mito_carr 209..298 CDD:278578 59/89 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4843
eggNOG 1 0.900 - - E1_KOG0749
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68194
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54049
OrthoDB 1 1.010 - - D440386at33208
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100505
Panther 1 1.100 - - O PTHR45635
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R28
SonicParanoid 1 1.000 - - X286
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.