DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and slc25a25

DIOPT Version :10

Sequence 1:NP_511110.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_017951721.1 Gene:slc25a25 / 496462 XenbaseID:XB-GENE-5933194 Length:525 Species:Xenopus tropicalis


Alignment Length:148 Identity:31/148 - (20%)
Similarity:52/148 - (35%) Gaps:27/148 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PHPAPAPCSGGNIVQGYVGAPQQGGYAAAP--QYPQQGGYGGAQQGFQAAPAPYQPQGGYQAGPA 99
            |.|:|.|.....|:     .|....|.:.|  :||.........:.:..:..|..||.....|..
 Frog   361 PPPSPLPFPTQAIL-----PPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSG 420

  Fly   100 PVQGYQPQAQVPAGGYQAPV-QPAPGPAEVAPAQVQAGGNYQDAPAQVAEVATAQESAPPPSEAA 163
            .|.|..|       |:..|| .|:|.|:.|.|..:        :......:.|:.|:    ..|:
 Frog   421 QVVGKVP-------GHFTPVLAPSPHPSAVRPVTL--------SMTDTKPITTSTEA----YTAS 466

  Fly   164 YTGEQEVVASLAREEPNY 181
            .|.:......|:..:|::
 Frog   467 GTSQANRYVGLSPRDPSF 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_511110.1 PTZ00169 15..305 CDD:240302 31/148 (21%)
slc25a25XP_017951721.1 FRQ1 55..199 CDD:444056
PTZ00169 247..501 CDD:240302 31/148 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.