DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and mfrn

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:193 Identity:44/193 - (22%)
Similarity:89/193 - (46%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MDFMMGGVSAAIAKTAV-APIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRG 83
            :::::.|..|.:...|: :|.:.:|..:|:.        :..|..:|.|...|.|.:||.:|:|.
  Fly   108 LNYVISGAVATLIHDAISSPTDVIKQRMQMY--------NSPYTSVVSCVRDIYKREGFKAFYRA 164

  Fly    84 NLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFAR 148
            ....::...|.|.::|...:.:::    .::..:::  :...::|:|.||||.:.....|||..:
  Fly   165 YGTQLVMNLPYQTIHFTTYEFFQN----KMNLERKY--NPPVHMAAGAAAGACAAAVTTPLDVIK 223

  Fly   149 TRL-AADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRG----FIVSVQGIVIYRAAY--FGFY 204
            |.| ..:.|.     ..|:|:...|:....||:|.:||    .:.|:....|..:.|  |.||
  Fly   224 TLLNTQETGL-----TRGMIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEFFKFY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 44/193 (23%)
Mito_carr 17..111 CDD:278578 18/91 (20%)
Mito_carr 119..215 CDD:278578 26/93 (28%)
Mito_carr 218..307 CDD:278578
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578
PTZ00168 17..280 CDD:185494 42/190 (22%)
Mito_carr 107..190 CDD:278578 18/93 (19%)
Mito_carr <215..282 CDD:278578 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.