DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and CG5805

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:337 Identity:76/337 - (22%)
Similarity:133/337 - (39%) Gaps:67/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GGGGHGKGDLKSFLMDFM-------MGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKG 63
            ||...|...:::...|.|       :..:|:...:..:.|:..:|..||||..|      ..|||
  Fly    20 GGAAEGATYIRTIEWDMMNKTKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHKS------DVYKG 78

  Fly    64 IVDCFIRIPKEQGFSSFWRG------NLANVIRYFPT-QALNFAFKDVYKSVFLGGVDKHKQFWR 121
            :|||.::|.:.:|....:||      .:.:.:.|..| :.:.....|      ||...:.|.   
  Fly    79 MVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYISTYEGVRHVLND------LGAGHRMKA--- 134

  Fly   122 HFAGNLASGGAAGATSLCFVYPLDFARTR-----LAADVGKGGNREFNGL------------IDC 169
                 ||.||.|.......:.|.|.....     ::|..|..|:....|:            :|.
  Fly   135 -----LAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDI 194

  Fly   170 LMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIAQVVTTVAG 234
            ..::::.||..|.|||:..|:...|...|.::.||...:|.|  .:..|.:||....|.|....|
  Fly   195 GREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDEL--FRICPVWVSHLFIQCVAGSLG 257

  Fly   235 -----IASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGA 294
                 |.:.|.|.||.|:.:.. |....:.::   ..|    ::|.:..||||..:.:::....:
  Fly   258 GFTTTILTNPLDIVRARLQVHR-LDSMSVAFR---ELW----QEEKLNCFFKGLSARLVQSAAFS 314

  Fly   295 LVLAL-YDEMKK 305
            ..:.| |:.:|:
  Fly   315 FSIILGYETIKR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 72/326 (22%)
Mito_carr 17..111 CDD:278578 23/107 (21%)
Mito_carr 119..215 CDD:278578 25/112 (22%)
Mito_carr 218..307 CDD:278578 22/94 (23%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 20/84 (24%)
Mito_carr 132..238 CDD:395101 26/115 (23%)
Mito_carr 245..327 CDD:395101 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.