DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and DPCoAC

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:298 Identity:86/298 - (28%)
Similarity:134/298 - (44%) Gaps:27/298 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LMDFMMGGVSAAIAKTAVAPIERVKLILQVQ-EVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWR 82
            ::..:.|..:.|:|||.:||::|.|:..|:: :|.....|..||  :.:.:    ..:|..:.||
  Fly    73 VISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRY--LQNTY----ANEGVLALWR 131

  Fly    83 GNLANVIRYFPTQALNFAFKDVYKSVFLGGVDK---HKQFWRHFAGNLASGGAAGATSLCFVYPL 144
            ||.|.:.|..|..|:.|...:.::.:.  .|||   :.:..|..||:|     ||.||....|||
  Fly   132 GNSATMARIVPYAAIQFTAHEQWRRIL--HVDKDGTNTKGRRFLAGSL-----AGITSQSLTYPL 189

  Fly   145 DFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCR- 208
            |.||.|:|......|.|.   |.....|:...:||..|:||:..:|.|::.|....|..|:|.: 
  Fly   190 DLARARMAVTDRYTGYRT---LRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKR 251

  Fly   209 ---DFLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVI 270
               :.:.|.|.... ||.|...........||||.|.|||||............|.......:.|
  Fly   252 EYYEVVGNNKPNTL-VSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKI 315

  Fly   271 AKQEGI-GAFFKGALSNIIRG-TGGALVLALYDEMKKY 306
            .::||: ..|:||...|.|:| ....:..:.||.:|.:
  Fly   316 YREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAW 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 85/295 (29%)
Mito_carr 17..111 CDD:278578 24/92 (26%)
Mito_carr 119..215 CDD:278578 32/99 (32%)
Mito_carr 218..307 CDD:278578 26/91 (29%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/93 (26%)
Mito_carr 169..251 CDD:278578 31/89 (35%)
Mito_carr 279..356 CDD:278578 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.