DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and Dic1

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:301 Identity:66/301 - (21%)
Similarity:119/301 - (39%) Gaps:49/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLA 86
            :..||:::..|.....|::.:|:.||.|         |.:..:.....::.:|||...|:.|..|
  Fly    10 WFFGGLASVGAAMVTHPLDLIKVTLQTQ---------QGHLSVAQLIPKLAREQGVLVFYNGLSA 65

  Fly    87 NVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWR--HFAGNLASGGAAGATSLCFVYPLDFART 149
            :|:|..           .|.:...|..:..|::..  .|.|.:|..||:|........|.|....
  Fly    66 SVLRQL-----------TYSTARFGVYEAGKKYVNTDSFGGKVALAGASGLVGGIVGTPADMVNV 119

  Fly   150 RLAADV--GKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLP 212
            |:..||  .....|.:|...|.|::|.:.:|...|:.|...:....::.......|||..:.:| 
  Fly   120 RMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYL- 183

  Fly   213 NPKSTPFY-----VSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEM-----VYKNTAHCW 267
              .:||::     ..:..:.|..|:|...:.|.|.::.|.|   ..|..|.     :.|:|    
  Fly   184 --LATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSM---NAKPGEFNGLWDIVKHT---- 239

  Fly   268 LVIAKQEGIGAFFKGALSNIIR-GTGGALVLALYDEMKKYF 307
               ||...:| ||||.:...:| |....:.....::::..|
  Fly   240 ---AKLGPLG-FFKGYVPAFVRLGPHTIITFVFLEQLRLKF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 65/297 (22%)
Mito_carr 17..111 CDD:278578 18/88 (20%)
Mito_carr 119..215 CDD:278578 23/99 (23%)
Mito_carr 218..307 CDD:278578 21/99 (21%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 20/101 (20%)
PTZ00169 13..273 CDD:240302 65/293 (22%)
Mito_carr 89..184 CDD:278578 23/97 (24%)
Mito_carr 189..278 CDD:278578 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441936
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.