DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and GC2

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:299 Identity:76/299 - (25%)
Similarity:117/299 - (39%) Gaps:71/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLANVI 89
            |||:..|....|.|::.||..||.|.:...  .::.|..|.|||.:....:|:...:||:..|::
  Fly    27 GGVAGIIGVACVYPLDMVKTRLQNQTIGPN--GERMYTSIADCFRKTIASEGYFGMYRGSAVNIV 89

  Fly    90 RYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGN---------LASGGAAGATSLCFVYPLD 145
            ...|.:|:.....|.::              .|.|.:         ..:||.||...:....|::
  Fly    90 LITPEKAIKLTANDFFR--------------YHLASDDGVIPLSRATLAGGLAGLFQIVVTTPME 140

  Fly   146 FARTRL-------AADVGKGGNREFN-----GLIDCLMKVIKSDGPIGLYRGFIVSVQGI--VIY 196
            ..:.::       |||  :...||..     ||...|   ::..|..|||:|  |...|:  :.:
  Fly   141 LLKIQMQDAGRVAAAD--RAAGREVKTITALGLTKTL---LRERGIFGLYKG--VGATGVRDITF 198

  Fly   197 RAAYFGFYDTCRDFLPNPK----STPFYVSWAIAQVVTTVAGIAS--------YPFDTVRRRMMM 249
            ...||.......|..|...    ...||  |::      :||:.|        .|||.|:.| :.
  Fly   199 SMVYFPLMAWINDQGPRKSDGSGEAVFY--WSL------IAGLLSGMTSAFMVTPFDVVKTR-LQ 254

  Fly   250 QSGLKKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNII 288
            ..|.||    :|....|.....|:|||.|||||.|..|:
  Fly   255 ADGEKK----FKGIMDCVNRTLKEEGISAFFKGGLCRIM 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 76/299 (25%)
Mito_carr 17..111 CDD:278578 23/85 (27%)
Mito_carr 119..215 CDD:278578 26/118 (22%)
Mito_carr 218..307 CDD:278578 27/79 (34%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 75/297 (25%)
Mito_carr 16..106 CDD:278578 23/80 (29%)
Mito_carr 123..203 CDD:278578 20/86 (23%)
Mito_carr 228..302 CDD:278578 24/73 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.