DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and GC1

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:292 Identity:74/292 - (25%)
Similarity:124/292 - (42%) Gaps:37/292 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFW 81
            :.|...:.||::..|..|.|.|::.||..||.|::...  .::.|..:.|||.:..|.:|:...:
  Fly    20 ALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPN--GERMYNSMFDCFRKTYKAEGYFGMY 82

  Fly    82 RGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRH----FAGNLASGGAAGATSLCFVY 142
            ||:..|::...|.:|:.....|.:         :||...:.    ....:.:||.|||..:....
  Fly    83 RGSGVNILLITPEKAIKLTANDYF---------RHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTT 138

  Fly   143 PLDFARTRLAADVGK--------GGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGI--VIYR 197
            |::..:.:: .|.|:        |...|.........::||..|..|||:|  :...|:  |.:.
  Fly   139 PMELLKIQM-QDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKG--IGATGLRDVTFS 200

  Fly   198 AAYFGFYDTCRDFLPNPK----STPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKS-- 256
            ..||..:.|..|..|...    ...|:.|:.......:.|.:|..|||.|:.|:   ..:||:  
  Fly   201 IIYFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRL---QAIKKADG 262

  Fly   257 EMVYKNTAHCWLVIAKQEGIGAFFKGALSNII 288
            |..:|..:.|.....|.||..|||||.|..:|
  Fly   263 EKEFKGISDCITKTLKHEGPTAFFKGGLCRMI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 74/292 (25%)
Mito_carr 17..111 CDD:278578 24/93 (26%)
Mito_carr 119..215 CDD:278578 24/109 (22%)
Mito_carr 218..307 CDD:278578 24/73 (33%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 22/87 (25%)
Mito_carr 115..213 CDD:278578 22/100 (22%)
Mito_carr 226..307 CDD:278578 24/72 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.