DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and Tpc1

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:347 Identity:83/347 - (23%)
Similarity:143/347 - (41%) Gaps:92/347 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KGDLKSFLMDFMMGGVSAAIAKTAVAPIE--RVKLILQVQEVSKQIAAD------QRYKGIVDCF 68
            |...:..|...:.||:||||.::...|::  :::..|||:.:.|..|.:      .:|..|....
  Fly    22 KHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAV 86

  Fly    69 IRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFW------------- 120
            ..|.:|:|..:||:|       :.|.|.|:..:          |:   .|||             
  Fly    87 KTIYREEGMLAFWKG-------HNPAQVLSIMY----------GI---CQFWTYEQLSLMAKQTS 131

  Fly   121 -----RHFAGNLASGGAAGATSLCFVYPLDFARTRL-AADVGKGGNREFNGLIDCLMKVIKSDGP 179
                 :|.: |...|.|||..::....|||..|||| |.|..||    :......:..:::.:||
  Fly   132 YLADHQHLS-NFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKG----YRNATRAVSAIVRQEGP 191

  Fly   180 IGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIA--------QVVT-TVAGI 235
            .|:|||...::..|.......|..|....|             ||.|        |:.| |:.|:
  Fly   192 RGMYRGLSSALLQITPLMGTNFMAYRLFSD-------------WACAFLEVSDRSQLPTWTLLGL 243

  Fly   236 AS----------YPFDTVRRRMMMQSGLKKSEMVYKNTAHC---W---LVIAKQEGIGAFFKGAL 284
            .:          ||||.:::|:.:| |.:.:...:..|..|   |   .:..:|||:...:||..
  Fly   244 GASSGMLSKTIVYPFDLIKKRLQIQ-GFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVA 307

  Fly   285 SNIIRGT-GGALVLALYDEMKK 305
            ..:::.: ..||..::||::|:
  Fly   308 PTLLKSSMTTALYFSIYDKLKQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 81/342 (24%)
Mito_carr 17..111 CDD:278578 24/101 (24%)
Mito_carr 119..215 CDD:278578 29/114 (25%)
Mito_carr 218..307 CDD:278578 27/114 (24%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 28/113 (25%)
PTZ00169 33..329 CDD:240302 80/334 (24%)
Mito_carr 153..222 CDD:278578 21/85 (25%)
Mito_carr 233..328 CDD:278578 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.