DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and CG2616

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:397 Identity:71/397 - (17%)
Similarity:141/397 - (35%) Gaps:102/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GGGGGHGKG------------------------------DLKSF--------------LMDFMMG 25
            |||||.|.|                              |.||.              |...:..
  Fly    33 GGGGGGGTGGSGGSGGTSGGNNLKPERSAREDDAINRLTDSKSSHRKLLSDPRFQIRPLQQVISA 97

  Fly    26 GVSAAIAKTAVAPIERVKLILQVQEV-----------------------SKQIAADQR--YKGIV 65
            ...|.|....:.|::.:|..:|.|:.                       |:..:..||  :....
  Fly    98 CTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSW 162

  Fly    66 DCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKH---KQFWRHF---- 123
            |..::|.:.:|.::.|.|....::...|:..:.|...:.:|:.:|...:.|   .|..||.    
  Fly   163 DALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRD 227

  Fly   124 -------AGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIG 181
                   ...:.||..|...::..|.|::..||::.|.     .:.:..::..:..|:...|..|
  Fly   228 TKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ-----RQTYAQMLQFVRSVVALQGVWG 287

  Fly   182 LYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRR 246
            |:||...::...|.:...|:..|::.:..|.:.....|.:|:....:..|||.|.:.|||.|:..
  Fly   288 LWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTH 352

  Fly   247 MMMQSGLKKSEMVY----------KNTAHCWLVIAKQEGIGAFFKGALSNIIR-GTGGALVLALY 300
            ..::.|   ..:::          |:|......|.:..|:...|.|....::: ....|::::.:
  Fly   353 EQIEFG---ERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTF 414

  Fly   301 DEMKKYF 307
            :..|.:|
  Fly   415 EYSKSFF 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 61/353 (17%)
Mito_carr 17..111 CDD:278578 19/132 (14%)
Mito_carr 119..215 CDD:278578 20/106 (19%)
Mito_carr 218..307 CDD:278578 19/99 (19%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 18/120 (15%)
Mito_carr 230..321 CDD:278578 18/95 (19%)
Mito_carr 321..425 CDD:278578 20/104 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.