DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and Dic4

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:315 Identity:71/315 - (22%)
Similarity:131/315 - (41%) Gaps:47/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HGKGDL----KSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIR 70
            |..||.    :..|..:..||.::.....|||||:.||..:|:|...:.|....:         |
  Fly     7 HFLGDCHDEPEGLLPRWWFGGFASMCVAFAVAPIDIVKTHMQIQRQKRSILGTVK---------R 62

  Fly    71 IPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGA 135
            |...:|:..|:.|..|.::|...:..::|...|..|.  :..||:..     :.|.:..|..|||
  Fly    63 IHSLKGYLGFYDGFSAAILRQMTSTNIHFIVYDTGKK--MEYVDRDS-----YLGKIILGCVAGA 120

  Fly   136 TSLCFVYPLDFARTRLAADVGKG--GNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRA 198
            ....|..|.|....|:..|:.:.  ..|.:..:.|.|:::.|.:|...||:|..|:|....:...
  Fly   121 CGSAFGIPTDLINVRMQTDMKEPPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTC 185

  Fly   199 AYFGFYD----------TCRDFLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGL 253
            :...|||          :..|.||        :.:..:...:.::...::|.|.| |.:||.|..
  Fly   186 SQIAFYDIIKTEVRKNISVNDGLP--------LHFLTSLGTSIISSAITHPLDVV-RTIMMNSRP 241

  Fly   254 KKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIR-GTGGALVLALYDEMKKYF 307
            .:...|::.:.|     ..:.|:...::|.:..|:| .....|:..||::::.:|
  Fly   242 GEFRTVFQASVH-----MMRFGVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLHF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 67/306 (22%)
Mito_carr 17..111 CDD:278578 23/93 (25%)
Mito_carr 119..215 CDD:278578 26/107 (24%)
Mito_carr 218..307 CDD:278578 16/89 (18%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 66/291 (23%)
Mito_carr 26..100 CDD:278578 22/84 (26%)
Mito_carr 104..201 CDD:278578 24/101 (24%)
Mito_carr 211..292 CDD:278578 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.