DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and CG6893

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:187 Identity:47/187 - (25%)
Similarity:79/187 - (42%) Gaps:22/187 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SGGAAGATSLCFVYPLDFARTRLAA---DVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSV 190
            |||.|||.:.||..|.|....|:..   |.|...|         |.:.|::.|.|.||.|....:
  Fly    20 SGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASN---------LQQAIRTHGFISLYDGLSAQL 75

  Fly   191 QGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGL-K 254
            ...:.|.:..|..|:..::.|.:|......|  .:|.:...|||:...|.:.:..||.:...| |
  Fly    76 LRQLTYTSMRFHLYEMGKEHLDDPAGLLDKV--LVAALAGCVAGVVGTPMELINTRMQVNRALPK 138

  Fly   255 KSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGALVL----ALYDEMKKYF 307
            ::...|:|.......:.::||....:.|...:.:|   .:|:.    |.||:.|:.:
  Fly   139 ETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMR---SSLITISQNAAYDQAKQIY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 46/183 (25%)
Mito_carr 17..111 CDD:278578
Mito_carr 119..215 CDD:278578 25/88 (28%)
Mito_carr 218..307 CDD:278578 21/93 (23%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 24/84 (29%)
Mito_carr 98..192 CDD:395101 22/98 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.