DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and SCaMC

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:284 Identity:82/284 - (28%)
Similarity:139/284 - (48%) Gaps:35/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLANVI 89
            ||::.|:::|..||::|:|:.||||        .|| .||.:|...:..|.|..|.||||..||:
  Fly   292 GGIAGAVSRTCTAPLDRIKVYLQVQ--------TQR-MGISECMHIMLNEGGSRSMWRGNGINVL 347

  Fly    90 RYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFARTRLAAD 154
            :..|..|..||..:..|.: :.|.|..:|.  .......:|.|||..|...:||::..:||||  
  Fly   348 KIAPETAFKFAAYEQMKRL-IRGDDGSRQM--SIVERFYAGAAAGGISQTIIYPMEVLKTRLA-- 407

  Fly   155 VGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTC-RDFL---PNPK 215
            :.:.|  ::.|:.|..:|:.|.:|....|||::.::.||:.|.......|:|. |.::   .|.:
  Fly   408 LRRTG--QYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNE 470

  Fly   216 STPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSG------LKKSEMVYKNT-AH-------- 265
            ...|.|..|.....:|:..:.|||...||.|:..|:.      .:|:::..|:: ||        
  Fly   471 QPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTG 535

  Fly   266 CWLVIAKQEGIGAFFKGALSNIIR 289
            .:..|.:|||:...::|...|.::
  Fly   536 LFRKIVRQEGLTGLYRGITPNFLK 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 82/284 (29%)
Mito_carr 17..111 CDD:278578 31/85 (36%)
Mito_carr 119..215 CDD:278578 27/99 (27%)
Mito_carr 218..307 CDD:278578 21/87 (24%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 31/87 (36%)
Mito_carr 375..463 CDD:278578 27/93 (29%)
Mito_carr 470..581 CDD:278578 21/90 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.