Sequence 1: | NP_001259432.1 | Gene: | Ant2 / 32008 | FlyBaseID: | FBgn0025111 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_647924.2 | Gene: | CG18418 / 38572 | FlyBaseID: | FBgn0035568 | Length: | 311 | Species: | Drosophila melanogaster |
Alignment Length: | 208 | Identity: | 61/208 - (29%) |
---|---|---|---|
Similarity: | 90/208 - (43%) | Gaps: | 30/208 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 GVDK-----HKQFWRHFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGGNREFNGLIDCLM 171
Fly 172 KVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIAQVVTTVAG-- 234
Fly 235 --IASYPFDTVRRRMMMQSGL-KKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGALV 296
Fly 297 -----LALYDEMK 304 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ant2 | NP_001259432.1 | PTZ00169 | 15..305 | CDD:240302 | 61/208 (29%) |
Mito_carr | 17..111 | CDD:278578 | |||
Mito_carr | 119..215 | CDD:278578 | 28/95 (29%) | ||
Mito_carr | 218..307 | CDD:278578 | 28/97 (29%) | ||
CG18418 | NP_647924.2 | Mito_carr | 10..108 | CDD:278578 | 30/108 (28%) |
PTZ00169 | 18..296 | CDD:240302 | 57/196 (29%) | ||
Mito_carr | 109..205 | CDD:278578 | 27/94 (29%) | ||
Mito_carr | 208..300 | CDD:278578 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45442054 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |