DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and CG7514

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:286 Identity:70/286 - (24%)
Similarity:125/286 - (43%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KGDLKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQG 76
            |..:..::| ::.||::..:....|.|::.||..:|:.      |....||...||.:::.|.:|
  Fly     7 KKSIPGYMM-YINGGLAGMLGTCIVQPLDLVKTRMQIS------ATTGEYKSSFDCLLKVFKNEG 64

  Fly    77 FSSFWRGNLANVIRY--FPTQALNFAFK--DVYKSVFLGGVDKHKQFWRHFAGN-----LASGG- 131
            ..:.:.|..|.::|.  :.|..:.|...  |.|:          |||      |     |||.| 
  Fly    65 ILALYNGLSAGLMRQATYTTARMGFYQMEIDAYR----------KQF------NAPPTVLASMGM 113

  Fly   132 --AAGATSLCFVYPLDFARTRLAAD--VGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQG 192
              .|||....|..|.:.|..|:.:|  :.....|.:.|:::..::::|.:|.|.|::|.:.:|..
  Fly   114 GILAGAFGAMFGNPAEVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGR 178

  Fly   193 IVIYRAAYFGFYDTCR-DFLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKS 256
            .:|........|...: .|.........:::.|:...:.|.  |||.|.|..:.|:..|   |.:
  Fly   179 AMIVNMVQLASYSQLKAAFSEYFSGLSLHIAAAMMSGLLTT--IASMPLDMAKTRIQQQ---KTA 238

  Fly   257 EMVYKNTAHCWLVIAKQEGIGAFFKG 282
            |  ||.|....:.::|.|||.:.:||
  Fly   239 E--YKGTMDVLMKVSKNEGIASLWKG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 69/283 (24%)
Mito_carr 17..111 CDD:278578 22/97 (23%)
Mito_carr 119..215 CDD:278578 25/106 (24%)
Mito_carr 218..307 CDD:278578 20/65 (31%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 68/276 (25%)
Mito_carr 19..90 CDD:278578 18/76 (24%)
Mito_carr 104..201 CDD:278578 23/96 (24%)
Mito_carr 207..284 CDD:278578 20/63 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.