DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and CG8323

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:299 Identity:69/299 - (23%)
Similarity:129/299 - (43%) Gaps:26/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DFMMGGVSAAIAKTAVAPIERVKLILQVQ-EVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGN 84
            ||::||:::..|.....|||.:|..:|:| |::.:....:.|||||:.||.:.|..|.:...:| 
  Fly     5 DFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKG- 68

  Fly    85 LANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRH-------FAGNLASGGAAGATSLCFVY 142
            ||..: ||     .|.......|::...:::.   |.|       :...|..|...|.....|..
  Fly    69 LAPAL-YF-----QFIINSFRLSIYSEAMERR---WMHNRKGEVSYGMGLLWGAIGGVVGCYFSS 124

  Fly   143 PLDFARTRLAADVGK----GGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGF 203
            |....:|:|.:...|    |.......:.|.|.::...:|..||:||.:.::....:...|....
  Fly   125 PFFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIAT 189

  Fly   204 YDTCRDFLP--NPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQS-GLKKSEMVYKNTAH 265
            :...:..|.  :..:.|...|::...:..::..:|..|.|.:..|:..|. ..:...::|:....
  Fly   190 FGKTKALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLD 254

  Fly   266 CWLVIAKQEGIGAFFKGALSNIIR-GTGGALVLALYDEM 303
            |::.|.:.||:...:||..:|.:| .....|||..:||:
  Fly   255 CFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 69/299 (23%)
Mito_carr 17..111 CDD:278578 28/90 (31%)
Mito_carr 119..215 CDD:278578 20/108 (19%)
Mito_carr 218..307 CDD:278578 21/88 (24%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 28/88 (32%)
PTZ00169 5..293 CDD:240302 68/297 (23%)
Mito_carr 101..200 CDD:278578 18/98 (18%)
Mito_carr 206..301 CDD:278578 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.