DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and CG8026

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:299 Identity:74/299 - (24%)
Similarity:127/299 - (42%) Gaps:29/299 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DFMMGGVSAAIAKTAVA-PIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGN 84
            :.::.|||..:..|.:. |::.:|:...|.:  .:.|...:|:|:...|..|.:::||...::|.
  Fly    24 EHLVAGVSGGVVSTLILHPLDLIKIRFAVND--GRTATVPQYRGLSSAFTTIFRQEGFRGLYKGV 86

  Fly    85 LANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAG---NLASGGAAGATSLCFVYPLDF 146
            ..||.....:..|.|.|.:..|:...||.....      .|   |:.:...:|..:|....|:..
  Fly    87 TPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMP------LGPTMNMLAAAESGILTLLLTNPIWV 145

  Fly   147 ARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFL 211
            .:|||........:.|:.|:|..|.::.|.:|..||||||:..:.| |.:.|..|..|:..::..
  Fly   146 VKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLG-VSHGAIQFMTYEELKNAY 209

  Fly   212 PNPKSTPF--------YVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWL 268
            ...:..|.        |:  |.|.|...:|..|:||:..||.|      |:.....|..|..|..
  Fly   210 NEYRKLPIDTKLATTEYL--AFAAVSKLIAAAATYPYQVVRAR------LQDHHHRYNGTWDCIK 266

  Fly   269 VIAKQEGIGAFFKGALSNIIRGTGGALVLALYDEMKKYF 307
            ...:.||...|:||..:::.|.....:|..|..|...:|
  Fly   267 QTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 73/295 (25%)
Mito_carr 17..111 CDD:278578 21/90 (23%)
Mito_carr 119..215 CDD:278578 25/98 (26%)
Mito_carr 218..307 CDD:278578 25/96 (26%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 69/279 (25%)
Mito_carr 23..115 CDD:278578 22/92 (24%)
Mito_carr 119..213 CDD:278578 25/100 (25%)
Mito_carr 220..307 CDD:278578 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.