DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and MME1

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:281 Identity:73/281 - (25%)
Similarity:114/281 - (40%) Gaps:33/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLA 86
            |:.|||..........|::.:|:.||....... ....||||::||..|..:.:||..|:||..|
  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRGFYRGISA 81

  Fly    87 NVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFARTRL 151
            .::...|..|::||.....|.:|  ..|.|.:.  .:....|:|..||..|.....|.|..:..|
  Fly    82 PLVGVTPIYAVDFAVYAAGKRLF--QTDDHIRL--TYPQIFAAGALAGVCSALVTVPTDRIKVLL 142

  Fly   152 AADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDF---LPN 213
            .......|...:||.||...|:.:..|...|::|...     .|.|.:..|||....:|   |..
  Fly   143 QTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCA-----CILRDSPTGFYFVTYEFLQELAR 202

  Fly   214 PKSTPFYVSWAIAQVVTTVAGIA----SYPFDTVRRRMM------MQSGLKKSEMVYKNTAHCWL 268
            .||....:|.....:....|||.    :.|||.::.|:.      .:.|::.   |::|      
  Fly   203 KKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRS---VFRN------ 258

  Fly   269 VIAKQEGIGAFFKGALSNIIR 289
             :...||..|.|:|.|..::|
  Fly   259 -LMATEGPKALFRGILPILLR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 73/281 (26%)
Mito_carr 17..111 CDD:278578 27/88 (31%)
Mito_carr 119..215 CDD:278578 24/98 (24%)
Mito_carr 218..307 CDD:278578 18/82 (22%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 27/91 (30%)
Mito_carr 111..205 CDD:278578 24/100 (24%)
Mito_carr 208..297 CDD:278578 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.