DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and Ucp4C

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:280 Identity:64/280 - (22%)
Similarity:118/280 - (42%) Gaps:30/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VSAAIAKTAVAPIERVKLILQV--QEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLANVI 89
            :.|.:|::.|.|::..|..:||  ::..|...|...::..:...||:   :||.|.:.|..|.|.
  Fly    45 IGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRV---EGFKSLYAGFSAMVT 106

  Fly    90 RYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFARTRLAAD 154
            |.|...:|.....||::..||...:::::..:.:.. |.....||..:.....|.|..:.|:..:
  Fly   107 RNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMA-LGCSFTAGCIAQALANPFDIVKVRMQTE 170

  Fly   155 VGKGGNREF------NGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYD----TCRD 209
               |..|:.      |.::...:.:.:..|...:::|...|.....:......|.||    |.:.
  Fly   171 ---GRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKR 232

  Fly   210 FLPNPKSTPF-YVSWAIAQVVTTVAGIASYPFDTVRRRMMMQ----SGLKKSEMVYKNTAHCWLV 269
            .|...:..|. :||...|.:   .|.:.|.|.|.::.|||.|    ||   ..:.|||:..|...
  Fly   233 LLDLEEGLPLRFVSSMCAGL---TASVLSTPADVIKSRMMNQPVDESG---KNLYYKNSLDCVRK 291

  Fly   270 IAKQEGIGAFFKGALSNIIR 289
            :.::||:...:||.:....|
  Fly   292 LVREEGVLTLYKGLMPTWFR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 64/280 (23%)
Mito_carr 17..111 CDD:278578 23/85 (27%)
Mito_carr 119..215 CDD:278578 17/105 (16%)
Mito_carr 218..307 CDD:278578 23/77 (30%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 21/77 (27%)
Mito_carr 137..232 CDD:278578 16/98 (16%)
Mito_carr 237..329 CDD:278578 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.