DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and Rim2

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:335 Identity:69/335 - (20%)
Similarity:124/335 - (37%) Gaps:76/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EGGGGGHGKGDLKSFLMDFMMGGVSAAIAKTAVAP--IERVKLILQVQEVSKQIAADQRYKGIVD 66
            |..|||...|.....|.......:|..|.:....|  |..|:.|:.:...... :...:...||.
  Fly    50 ENAGGGPANGGQSELLRPEQRRKLSTTILRNRSQPQVIGGVRRIMAISHCGIS-STTPKSMSIVQ 113

  Fly    67 CFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVF--LGGVDKHKQFWRHFAGNLAS 129
            |...|.:.:|..:.::|...|::...|::|:.|......|:..  ||.|::....     .::.|
  Fly   114 CLRHIVQNEGPRALFKGLGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPL-----VHIMS 173

  Fly   130 GGAAGATSLCFVYPLDFARTRLAADVGKGGNREFNGLI-----DCLMKVIKSDGPIGLYRGFIVS 189
            ..:||..|.....|:.|.:||:..|        :|..:     .|:.:|....|....|:|.   
  Fly   174 AASAGFVSSTATNPIWFVKTRMQLD--------YNSKVQMTVRQCIERVYAQGGVAAFYKGI--- 227

  Fly   190 VQGIVIYRAAYFGFYDT---------------------------CRDFLPNPKSTPFYVSWAIAQ 227
                   .|:|||..:|                           .||||      .|.::.|:::
  Fly   228 -------TASYFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRDFL------EFMMAGAVSK 279

  Fly   228 VVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRG-T 291
               |:|...:||.:..|.|:..:.....|   :..|.|   .:.|:||....::|..:.::|. .
  Fly   280 ---TIASCIAYPHEVARTRLREEGNKYNS---FWQTLH---TVWKEEGRAGLYRGLATQLVRQIP 335

  Fly   292 GGALVLALYD 301
            ..|:::|.|:
  Fly   336 NTAIMMATYE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 64/324 (20%)
Mito_carr 17..111 CDD:278578 18/97 (19%)
Mito_carr 119..215 CDD:278578 24/127 (19%)
Mito_carr 218..307 CDD:278578 19/85 (22%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 23/106 (22%)
Mito_carr 163..253 CDD:278578 20/112 (18%)
Mito_carr 268..355 CDD:278578 21/93 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.