DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and Ucp4A

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:303 Identity:70/303 - (23%)
Similarity:127/303 - (41%) Gaps:22/303 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAA---DQRYKGIVDCFIRIPKEQGFS 78
            ||...:::..|:|:||:.|..|::..|..||:|......:|   :.:|:|:|.....|.:|:|..
  Fly    39 SFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGAL 103

  Fly    79 SFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYP 143
            ..|:|....:.|:.....:.....|:.:..|.....:....|:    :...|..|||.:.....|
  Fly   104 KLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWK----SALCGVTAGAVAQWLASP 164

  Fly   144 LDFARTRLAADVGKGGNREFNG-------LIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYF 201
            .|..:.::..:    |.|...|       ......::::..|..||::|.|.:||...:......
  Fly   165 ADLVKVQIQME----GRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDL 225

  Fly   202 GFYDTCRDFLPNPKSTP-FYVSWAIAQVVT-TVAGIASYPFDTVRRRMMMQSGLKKSE-MVYKNT 263
            ..|||.:..:.|....| .:....:|.|.. .||.|...|.|.|:.|:|.|...:... ::|:.:
  Fly   226 TTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGS 290

  Fly   264 AHCWLVIAKQEGIGAFFKGALSNIIRGTGGALVLAL-YDEMKK 305
            ..|......:||..|.:||.|...||....:|...| :::::|
  Fly   291 VDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 69/301 (23%)
Mito_carr 17..111 CDD:278578 24/96 (25%)
Mito_carr 119..215 CDD:278578 21/102 (21%)
Mito_carr 218..307 CDD:278578 25/92 (27%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 70/303 (23%)
Mito_carr 39..138 CDD:278578 24/98 (24%)
Mito_carr 142..239 CDD:278578 21/104 (20%)
Mito_carr 248..336 CDD:278578 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.