DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and slc25a4

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_999867.1 Gene:slc25a4 / 327067 ZFINID:ZDB-GENE-030131-5275 Length:298 Species:Danio rerio


Alignment Length:291 Identity:221/291 - (75%)
Similarity:244/291 - (83%) Gaps:1/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFW 81
            |||.||:.|||:|||:||||||||||||:||||..||||.||.:||||:||.:||||||||.|||
Zfish     7 SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADMQYKGIIDCVVRIPKEQGFLSFW 71

  Fly    82 RGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDF 146
            ||||||||||||||||||||||.||.:|||||||:.||||:||||||||||||||||||||||||
Zfish    72 RGNLANVIRYFPTQALNFAFKDKYKKIFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDF 136

  Fly   147 ARTRLAADVGKG-GNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDF 210
            ||||||||:||| ..|||.||.:|:.|:.||||..|||.||.||||||:||||||||.|||.:..
Zfish   137 ARTRLAADIGKGAAEREFTGLGNCVAKIFKSDGLRGLYLGFNVSVQGIIIYRAAYFGIYDTAKGM 201

  Fly   211 LPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEG 275
            ||:||.|...|||.|||.||.||||.||||||||||||||||.|.::::||.|..||..|||.||
Zfish   202 LPDPKHTHIVVSWMIAQTVTAVAGIISYPFDTVRRRMMMQSGRKGADIMYKGTIDCWKKIAKDEG 266

  Fly   276 IGAFFKGALSNIIRGTGGALVLALYDEMKKY 306
            ..|||||||||:|||.|||.||.||||:|||
Zfish   267 GKAFFKGALSNVIRGAGGAFVLVLYDEIKKY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 218/288 (76%)
Mito_carr 17..111 CDD:278578 75/93 (81%)
Mito_carr 119..215 CDD:278578 73/96 (76%)
Mito_carr 218..307 CDD:278578 63/89 (71%)
slc25a4NP_999867.1 Mito_carr 6..101 CDD:278578 75/93 (81%)
PTZ00169 7..296 CDD:240302 218/288 (76%)
Mito_carr 109..206 CDD:278578 73/96 (76%)
Mito_carr 206..297 CDD:278578 63/90 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4843
eggNOG 1 0.900 - - E1_KOG0749
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54049
OrthoDB 1 1.010 - - D440386at33208
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100505
Panther 1 1.100 - - O PTHR45635
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R28
SonicParanoid 1 1.000 - - X286
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.