DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and sesB

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:292 Identity:235/292 - (80%)
Similarity:259/292 - (88%) Gaps:0/292 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DLKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFS 78
            |...|:.||..||:|||::||||||||||||:||||.:||||:.|::|||:||||||||||||||
  Fly    19 DAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFS 83

  Fly    79 SFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYP 143
            |||||||||||||||||||||||||.||.||||||||:.||||:|||||||||||||||||||||
  Fly    84 SFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYP 148

  Fly   144 LDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCR 208
            |||||||||||.||||.|||.||.:||.|:.||||.:||||||.||||||:||||||||||||.|
  Fly   149 LDFARTRLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTAR 213

  Fly   209 DFLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQ 273
            ..||:||:||.|:||||||||||||||.||||||||||||||||.|.:|::||||.|||..||||
  Fly   214 GMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQ 278

  Fly   274 EGIGAFFKGALSNIIRGTGGALVLALYDEMKK 305
            ||.|||||||.|||:||||||.||.||||:||
  Fly   279 EGTGAFFKGAFSNILRGTGGAFVLVLYDEIKK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 232/289 (80%)
Mito_carr 17..111 CDD:278578 75/93 (81%)
Mito_carr 119..215 CDD:278578 78/95 (82%)
Mito_carr 218..307 CDD:278578 71/88 (81%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 76/96 (79%)
PTZ00169 23..312 CDD:240302 234/288 (81%)
Mito_carr 124..220 CDD:278578 78/95 (82%)
Mito_carr 223..312 CDD:278578 71/88 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468687
Domainoid 1 1.000 123 1.000 Domainoid score I1827
eggNOG 1 0.900 - - E1_KOG0749
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 297 1.000 Inparanoid score I797
Isobase 1 0.950 - 0 Normalized mean entropy S337
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39829at7147
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 1 1.000 - - mtm1006
orthoMCL 1 0.900 - - OOG6_100505
Panther 1 1.100 - - P PTHR45635
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R28
SonicParanoid 1 1.000 - - X286
1312.780

Return to query results.
Submit another query.