DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and R07E3.4

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_509733.1 Gene:R07E3.4 / 187678 WormBaseID:WBGene00011105 Length:298 Species:Caenorhabditis elegans


Alignment Length:284 Identity:132/284 - (46%)
Similarity:182/284 - (64%) Gaps:4/284 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 MMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLAN 87
            :.|..:|||:||..||.:||||:||:|..|:...|:  |.||.||..:|..|||..:.||||.|.
 Worm    18 LAGSAAAAISKTTTAPFDRVKLVLQLQRQSEFAMAE--YNGIRDCISKIRLEQGAMALWRGNGAG 80

  Fly    88 VIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFARTRLA 152
            |.|..|...|||||:|:|::..|..||:::.|.:..||...|||..|||:|..:||.||||||||
 Worm    81 VARCLPNHTLNFAFRDIYRNTLLKNVDRNESFGKFLAGTFVSGGLGGATTLFMLYPFDFARTRLA 145

  Fly   153 ADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKST 217
            .||.|.|:|::.|::|||.|:..|:|....|:|...::|.::..||.:||.:|:.|..:.:|||.
 Worm   146 LDVKKDGSRKYKGMVDCLKKIKASEGVASWYKGLSSALQFVIASRAIFFGIFDSIRTSVEDPKSL 210

  Fly   218 PFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEGIGAFFKG 282
            .|...|||||:..|.:|:..||.|||||.||||||  |....|.:|..||..:.|::||..|::|
 Worm   211 NFAACWAIAQISITTSGMVCYPLDTVRRSMMMQSG--KQIKQYTSTKDCWKTLYKKDGINGFYRG 273

  Fly   283 ALSNIIRGTGGALVLALYDEMKKY 306
            ||:|.:|.|||||::..|.|..||
 Worm   274 ALTNSLRSTGGALIITFYYEFSKY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 130/281 (46%)
Mito_carr 17..111 CDD:278578 41/87 (47%)
Mito_carr 119..215 CDD:278578 41/95 (43%)
Mito_carr 218..307 CDD:278578 44/89 (49%)
R07E3.4NP_509733.1 Mito_carr 9..105 CDD:278578 42/88 (48%)
PTZ00169 18..298 CDD:240302 132/284 (46%)
Mito_carr 115..202 CDD:278578 39/86 (45%)
Mito_carr 208..296 CDD:278578 44/89 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166295
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0749
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D440386at33208
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.