DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ant2 and si:dkey-251i10.1

DIOPT Version :9

Sequence 1:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001083023.1 Gene:si:dkey-251i10.1 / 100038774 ZFINID:ZDB-GENE-060531-122 Length:299 Species:Danio rerio


Alignment Length:291 Identity:201/291 - (69%)
Similarity:236/291 - (81%) Gaps:2/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFW 81
            ||..||:.|||:||:::|||||||||||:||||..||||..|::|||||||.:|||:||||.|||
Zfish     7 SFAKDFLAGGVAAAVSETAVAPIERVKLLLQVQHASKQITTDKQYKGIVDCVVRIPREQGFLSFW 71

  Fly    82 RGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDF 146
            |||||||||||.||||||||||.|:.:||.|||:..||||:||||||:||||||||||.||||||
Zfish    72 RGNLANVIRYFLTQALNFAFKDKYRKIFLDGVDQRTQFWRYFAGNLAAGGAAGATSLCLVYPLDF 136

  Fly   147 ARTRLAADVGKGG--NREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRD 209
            |||||||||||.|  .|||.||.:||:|:.:|||..|||:||.||||||:||||||||.|||.:.
Zfish   137 ARTRLAADVGKTGTAGREFKGLANCLVKIYRSDGVRGLYQGFNVSVQGIIIYRAAYFGIYDTAKG 201

  Fly   210 FLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQE 274
            .||:|::|...|||.||..||.|||..|||||||||.||||||||.::::|..:..||..||:.|
Zfish   202 MLPDPENTHIAVSWMIAHTVTIVAGFISYPFDTVRRSMMMQSGLKGADVMYSGSIDCWRKIARNE 266

  Fly   275 GIGAFFKGALSNIIRGTGGALVLALYDEMKK 305
            |..||||||.||::|..||::||.||||.||
Zfish   267 GPKAFFKGAWSNVLRSLGGSIVLVLYDEFKK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 199/289 (69%)
Mito_carr 17..111 CDD:278578 69/93 (74%)
Mito_carr 119..215 CDD:278578 72/97 (74%)
Mito_carr 218..307 CDD:278578 53/88 (60%)
si:dkey-251i10.1NP_001083023.1 Mito_carr 4..101 CDD:278578 69/93 (74%)
PTZ00169 7..299 CDD:240302 201/291 (69%)
Mito_carr 126..205 CDD:278578 56/78 (72%)
Mito_carr 213..299 CDD:278578 53/85 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4843
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54049
OrthoDB 1 1.010 - - D440386at33208
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45635
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X286
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.