DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and PM-ANT

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_200456.1 Gene:PM-ANT / 835746 AraportID:AT5G56450 Length:330 Species:Arabidopsis thaliana


Alignment Length:298 Identity:133/298 - (44%)
Similarity:182/298 - (61%) Gaps:10/298 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPD------KQYKGMVDCFIRIPKEQG 81
            |.||..||.:...|..|.||||||.|||||.|..:..|..|      :::|||.|...|..:|:|
plant    30 FQKDLLAGAVMGGVVHTIVAPIERAKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRTVREEG 94

  Fly    82 FSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFV 146
            ..|.||||.::|:||:|:.||||:.||.|:.:......:....:.....|..:|.|||.|:|..|
plant    95 VLSLWRGNGSSVLRYYPSVALNFSLKDLYRSILRNSSSQENHIFSGALANFMAGSAAGCTALIVV 159

  Fly   147 YPLDFARTRLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDT 211
            ||||.|.||||||.||...|:|.|:.:.|:.|.|.||:.|:|||...|:.|:||:|..|||.:||
plant   160 YPLDIAHTRLAADIGKPEARQFRGIHHFLSTIHKKDGVRGIYRGLPASLHGVIIHRGLYFGGFDT 224

  Fly   212 ARGMLPDPKNTPIYI--SWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWAT 274
            .:.:..:.....:.:  .|.:||.|||.||:.|||.||||||:|||||.:  ..:|::||.||..
plant   225 VKEIFSEDTKPELALWKRWGLAQAVTTSAGLASYPLDTVRRRIMMQSGME--HPMYRSTLDCWKK 287

  Fly   275 IAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 312
            |.:.||..:|::||.||:.|.||.|.:||.|||:|:.|
plant   288 IYRSEGLASFYRGALSNMFRSTGSAAILVFYDEVKRFL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 44/98 (45%)
PTZ00169 23..312 CDD:240302 132/296 (45%)
Mito_carr 124..220 CDD:278578 43/95 (45%)
Mito_carr 223..312 CDD:278578 45/90 (50%)
PM-ANTNP_200456.1 PTZ00169 27..325 CDD:240302 132/296 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2331
eggNOG 1 0.900 - - E1_KOG0749
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54049
OrthoDB 1 1.010 - - D870903at2759
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100505
Panther 1 1.100 - - O PTHR45635
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.790

Return to query results.
Submit another query.