DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and Slc25a31

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_038959558.1 Gene:Slc25a31 / 689108 RGDID:1596195 Length:320 Species:Rattus norvegicus


Alignment Length:313 Identity:222/313 - (70%)
Similarity:256/313 - (81%) Gaps:5/313 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNISASITSQSKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQ 65
            |.|.|:.  .||.....||.|.|.||..|||::|||||||||||||||||||||..||||||:.:
  Rat     1 MSNNSSK--KQSSKKTLFDPVSFAKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEAR 63

  Fly    66 YKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAG 130
            ||||:||.:|||:||||.|:|||||||||||||||||||||||||||:|:.||:|..||||:|..
  Rat    64 YKGMIDCLVRIPREQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLA 128

  Fly   131 NLASGGAAGATSLCFVYPLDFARTRLAADTGKG-GQREFTGLGNCLTKIFKSDGIVGLYRGFGVS 194
            ||||||||||||||.|||||||||||..|.||| .||:|||||:|:.||.||||::|||:|||||
  Rat   129 NLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVS 193

  Fly   195 VQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRK 259
            |||||:|||:|||.|||.:|:||.||.||..||:.|||:|||.:||:||||||||||||||||. 
  Rat   194 VQGIIVYRASYFGAYDTVKGLLPKPKETPFLISFIIAQIVTTGSGILSYPFDTVRRRMMMQSGE- 257

  Fly   260 ATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 312
             :|..||.|:.|:..|...||..|||:|||||||||||||.||||||:||::|
  Rat   258 -SERQYKGTIDCFLKIYNHEGMAAFFRGAFSNILRGTGGALVLVLYDKIKELL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 77/96 (80%)
PTZ00169 23..312 CDD:240302 213/289 (74%)
Mito_carr 124..220 CDD:278578 72/96 (75%)
Mito_carr 223..312 CDD:278578 59/88 (67%)
Slc25a31XP_038959558.1 PTZ00169 20..309 CDD:240302 213/290 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54049
OrthoDB 1 1.010 - - D440386at33208
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100505
Panther 1 1.100 - - O PTHR45635
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X286
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.