DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and CG5805

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:332 Identity:79/332 - (23%)
Similarity:136/332 - (40%) Gaps:74/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQG 81
            ::|.:...|.|....:|:...:..:.|:..:|..|||||.|      ..|||||||.::|.:.:|
  Fly    33 EWDMMNKTKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHKS------DVYKGMVDCAMKIYRSEG 91

  Fly    82 FSSFWRG------NLANVIRYFPT-QALNFAFKDKYKQVFLGGVDKNTQFWRYFAGN----LASG 135
            ....:||      .:.:.:.|..| :.:.....|      ||            ||:    ||.|
  Fly    92 VPGLYRGFWISSVQIVSGVFYISTYEGVRHVLND------LG------------AGHRMKALAGG 138

  Fly   136 GAAGATSLCFVYPLDFARTR-----LAADTG-KG-----GQREFTG---------LGNCLTKIFK 180
            |.|.......:.|.|.....     ::|..| ||     |.:.:.|         :|.   :|.:
  Fly   139 GCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGR---EIMR 200

  Fly   181 SDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAG-----I 240
            .||..|.|||:..|:...:...|.::.||...:..|  .:..|:::|....|.|....|     |
  Fly   201 RDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDEL--FRICPVWVSHLFIQCVAGSLGGFTTTI 263

  Fly   241 VSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVL- 304
            ::.|.|.||.|:.:.. ..:..|.::   ..|    ::|....||||..:.:::....:|.::| 
  Fly   264 LTNPLDIVRARLQVHR-LDSMSVAFR---ELW----QEEKLNCFFKGLSARLVQSAAFSFSIILG 320

  Fly   305 YDEIKKV 311
            |:.||::
  Fly   321 YETIKRI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 26/103 (25%)
PTZ00169 23..312 CDD:240302 78/326 (24%)
Mito_carr 124..220 CDD:278578 28/119 (24%)
Mito_carr 223..312 CDD:278578 23/95 (24%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 22/84 (26%)
Mito_carr 132..238 CDD:395101 26/110 (24%)
Mito_carr 245..327 CDD:395101 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.