DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and DPCoAC

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:318 Identity:93/318 - (29%)
Similarity:141/318 - (44%) Gaps:29/318 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNISASITSQSKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQY 66
            |.:....|:.:.|.:..|.|  |....:|..:.|::||.:||::|.|:..|:::     .....:
  Fly    53 GVVLVPATTVTPMRQKIDQV--VISLISGAAAGALAKTVIAPLDRTKINFQIRN-----DVPFSF 110

  Fly    67 KGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDK---NTQFWRYF 128
            :..:.........:|..:.||||.|.:.|..|..|:.|...::::::.  .|||   ||:..|:.
  Fly   111 RASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRIL--HVDKDGTNTKGRRFL 173

  Fly   129 AGNLASGGAAGATSLCFVYPLDFARTRLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGV 193
            ||:|     ||.||....||||.||.|:|......|.|.   |....|||:..:|...|:||:..
  Fly   174 AGSL-----AGITSQSLTYPLDLARARMAVTDRYTGYRT---LRQVFTKIWVEEGPRTLFRGYWA 230

  Fly   194 SVQGIIIYRAAYFGFYDTARGMLPD--PKNTP-IYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQ 255
            :|.|:|.|....|..|:|.:....:  ..|.| ..:|.|............|||.|.|||||...
  Fly   231 TVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTM 295

  Fly   256 SGRKATEVIYKNTLHCWATIAKQEGT-GAFFKGAFSNILRG---TGGAFVLVLYDEIK 309
            ....|....|...|.....|.::||. ..|:||...|.::|   .|.:|  ..||.||
  Fly   296 RVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISF--STYDLIK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 22/96 (23%)
PTZ00169 23..312 CDD:240302 88/297 (30%)
Mito_carr 124..220 CDD:278578 33/97 (34%)
Mito_carr 223..312 CDD:278578 29/92 (32%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 21/95 (22%)
Mito_carr 169..251 CDD:278578 33/89 (37%)
Mito_carr 279..356 CDD:278578 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.