DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and GC2

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:297 Identity:75/297 - (25%)
Similarity:122/297 - (41%) Gaps:67/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVI 94
            ||::..:....|.|::.||..||.|.|..  :.::.|..:.|||.:....:|:...:||:..|::
  Fly    27 GGVAGIIGVACVYPLDMVKTRLQNQTIGP--NGERMYTSIADCFRKTIASEGYFGMYRGSAVNIV 89

  Fly    95 RYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLAS-------------GGAAGATSLCFV 146
            ...|.:|:.....|               |:||   :|||             ||.||...:...
  Fly    90 LITPEKAIKLTAND---------------FFRY---HLASDDGVIPLSRATLAGGLAGLFQIVVT 136

  Fly   147 YPLDFARTRL-------AADTGKGGQ-REFTGLGNCLTK-IFKSDGIVGLYRGFGVSVQGIIIYR 202
            .|::..:.::       |||...|.: :..|.||  ||| :.:..||.|||:|.|.:....|.:.
  Fly   137 TPMELLKIQMQDAGRVAAADRAAGREVKTITALG--LTKTLLRERGIFGLYKGVGATGVRDITFS 199

  Fly   203 AAYFGFYDTARGMLP---DPKNTPIYISWAIAQVVTTVAGIVS--------YPFDTVRRRMMMQS 256
            ..||..........|   |.....::. |::      :||::|        .|||.|:.|:....
  Fly   200 MVYFPLMAWINDQGPRKSDGSGEAVFY-WSL------IAGLLSGMTSAFMVTPFDVVKTRLQADG 257

  Fly   257 GRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNIL 293
            .:|     :|..:.|.....|:||..|||||....|:
  Fly   258 EKK-----FKGIMDCVNRTLKEEGISAFFKGGLCRIM 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 21/85 (25%)
PTZ00169 23..312 CDD:240302 75/297 (25%)
Mito_carr 124..220 CDD:278578 33/120 (28%)
Mito_carr 223..312 CDD:278578 21/79 (27%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 74/295 (25%)
Mito_carr 16..106 CDD:278578 22/95 (23%)
Mito_carr 123..203 CDD:278578 23/81 (28%)
Mito_carr 228..302 CDD:278578 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.