DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and CG16736

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:276 Identity:53/276 - (19%)
Similarity:98/276 - (35%) Gaps:76/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PIERVKLLLQ--VQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIR----YFPTQA 101
            |:|.|::.:|  |.|.|:.         .::...|:....|...|:.|.:|..:|    ...|..
  Fly    19 PMELVRVNMQANVIHHSRL---------SINHMFRLMARHGLPGFYYGIVAACLRCTVHTMSTYT 74

  Fly   102 LNFAFKDK--------YKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAA 158
            |.:..:|.        |....:.|:   |.||   .|.||:..|    .|..:...|..|     
  Fly    75 LFYNLQDNKYVLMLQPYNTSMVLGI---TGFW---GGVLATPFA----KLAVIRQADLTR----- 124

  Fly   159 DTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTP 223
              |...:|.:......|..::...|...|:.|:.::            ....||..:|..|.:..
  Fly   125 --GSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKIN------------SISSTAVAVLYTPISDK 175

  Fly   224 IY--ISWA-------IAQVVT-----TVAGIVSYPFDTVRRRMMMQS---GRKATEVIYKNTLHC 271
            ::  |||.       ::.::|     ::..::..|.|.:....:.:|   ||.:...:|:.    
  Fly   176 VHTVISWFHRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYRK---- 236

  Fly   272 WATIAKQEGTGAFFKG 287
               |.::.|...||.|
  Fly   237 ---IIRKHGYKGFFFG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 17/86 (20%)
PTZ00169 23..312 CDD:240302 53/276 (19%)
Mito_carr 124..220 CDD:278578 18/95 (19%)
Mito_carr 223..312 CDD:278578 15/82 (18%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 15/70 (21%)
Mito_carr 187..277 CDD:278578 12/70 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.