DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and Mpcp2

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:332 Identity:76/332 - (22%)
Similarity:125/332 - (37%) Gaps:57/332 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISASITSQSKMGKDFDAVGFVKDFAAGGI----SAAVSKTAVAPIERVKLLLQVQHISKQISPDK 64
            |:|:.|..:.. :|....|..|.||..||    |...:.|.|.|::.||..|||.        ..
  Fly    40 IAAAATPVANQ-QDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQVD--------QA 95

  Fly    65 QYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFA----FKDKYKQVFLGGVDKNTQFW 125
            :||.:|..|.....|:|.....:|....::.|.......|.    ||.||.:: :|  ::|...:
  Fly    96 KYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEI-IG--EENAYLY 157

  Fly   126 R---YFAGNLASGGAAGATSLCFVYPLDFARTRLAADTGKGGQ-REFTGLGNCLTKIFKSDGIVG 186
            |   |.|   ||..|.....:... |.:.|:.::....|.... ||      .:.|:.|.:|:..
  Fly   158 RTSLYLA---ASASAEFFADIALA-PFEAAKVKIQTIPGYANNFRE------AVPKMLKEEGVNA 212

  Fly   187 LYRGFGVSVQGIIIYRAAYFGFYDTA-----RGMLPDP-----KNTPIYISWAIAQVVTTVAGIV 241
            .|:|........|.|....|..::..     :.::|.|     |...:.:::|...:......:|
  Fly   213 FYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVV 277

  Fly   242 SYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILR-GTGGAFVLVLY 305
            |:|.|.|..::....|..|            .::||..|....:.|....|:. ||..|....:|
  Fly   278 SHPADVVVSKLNQAKGASA------------ISVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIY 330

  Fly   306 DEIKKVL 312
            |.:|..|
  Fly   331 DGVKVAL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 28/104 (27%)
PTZ00169 23..312 CDD:240302 70/311 (23%)
Mito_carr 124..220 CDD:278578 21/109 (19%)
Mito_carr 223..312 CDD:278578 19/89 (21%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 23/91 (25%)
Mito_carr <175..245 CDD:278578 13/76 (17%)
Mito_carr 260..338 CDD:278578 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.