DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and slc25a4

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_988909.1 Gene:slc25a4 / 394504 XenbaseID:XB-GENE-1001646 Length:298 Species:Xenopus tropicalis


Alignment Length:291 Identity:233/291 - (80%)
Similarity:259/291 - (89%) Gaps:1/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSF 85
            :.|:|||.||||:||:|||||||||||||||||||.|||||.||||||::||.:||||||||.||
 Frog     6 LSFLKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQISVDKQYKGIMDCVVRIPKEQGFISF 70

  Fly    86 WRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLD 150
            |||||||||||||||||||||||||||:|||||||:.||||:|.|||||||||||||||||||||
 Frog    71 WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRFFVGNLASGGAAGATSLCFVYPLD 135

  Fly   151 FARTRLAADTGKG-GQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARG 214
            |||||||||.||| .:|||||||||:.||:|.||:.|||:||.|||||||||||||||.||||:|
 Frog   136 FARTRLAADVGKGLNEREFTGLGNCIAKIYKLDGLKGLYQGFNVSVQGIIIYRAAYFGVYDTAKG 200

  Fly   215 MLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQE 279
            |:|||||..|.:||.|||.||.|||:|||||||||||||||||||..:::||.|:.||..|:|.|
 Frog   201 MMPDPKNVHIVVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYKGTIDCWKKISKDE 265

  Fly   280 GTGAFFKGAFSNILRGTGGAFVLVLYDEIKK 310
            |..||||||:||:|||.||||||||||||||
 Frog   266 GPKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 80/94 (85%)
PTZ00169 23..312 CDD:240302 233/289 (81%)
Mito_carr 124..220 CDD:278578 79/96 (82%)
Mito_carr 223..312 CDD:278578 64/88 (73%)
slc25a4NP_988909.1 PTZ00169 2..298 CDD:240302 233/291 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3730
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H36058
Inparanoid 1 1.050 481 1.000 Inparanoid score I1429
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D440386at33208
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 1 1.000 - - mtm9376
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R28
SonicParanoid 1 1.000 - - X286
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.