DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and SCaMC

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:311 Identity:87/311 - (27%)
Similarity:146/311 - (46%) Gaps:42/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGN 89
            :...||||:.|||:|..||::|:|:.||||         .|..|:.:|...:..|.|..|.||||
  Fly   287 RHLVAGGIAGAVSRTCTAPLDRIKVYLQVQ---------TQRMGISECMHIMLNEGGSRSMWRGN 342

  Fly    90 LANVIRYFPTQALNFAFKDKYKQVFLG--GVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFA 152
            ..||::..|..|..||..::.|::..|  |..:.:...|::|     |.|||..|...:||::..
  Fly   343 GINVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYA-----GAAAGGISQTIIYPMEVL 402

  Fly   153 RTRLA-ADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGML 216
            :|||| ..||     ::.|:.:...||:|.:|:...|||:..::.||:.|.......|:|.:...
  Fly   403 KTRLALRRTG-----QYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRY 462

  Fly   217 ---PDPKNTPIY-ISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSG------RKATEVIYKNT-LH 270
               .|....|.: :..|.....:|:..:.|||...||.|:..|:.      ::.|::..|:: .|
  Fly   463 IANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAH 527

  Fly   271 --------CWATIAKQEGTGAFFKGAFSNILRGTGGAFV-LVLYDEIKKVL 312
                    .:..|.:|||....::|...|.|:......: .|:|:...:.|
  Fly   528 SGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRAL 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 33/90 (37%)
PTZ00169 23..312 CDD:240302 86/309 (28%)
Mito_carr 124..220 CDD:278578 29/99 (29%)
Mito_carr 223..312 CDD:278578 22/105 (21%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 33/91 (36%)
Mito_carr 375..463 CDD:278578 28/97 (29%)
Mito_carr 470..581 CDD:278578 23/109 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.