DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and CG18418

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:294 Identity:67/294 - (22%)
Similarity:122/294 - (41%) Gaps:26/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLA 91
            |..||.|..::...|.|::.:|..:|   ||..:. .::||...:...::.|.:|..|.:.|..|
  Fly    18 FVMGGTSGMLATCIVQPLDLLKTRMQ---ISGTLG-TREYKNSFEVLSKVLKNEGILSLYNGLSA 78

  Fly    92 NVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRL 156
            .::|    ||...:.|....|:.|....||...:.....::..|..|||.......|.:.|..|:
  Fly    79 GLLR----QATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRM 139

  Fly   157 AADTG--KGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPD- 218
            .:|..  ...:|.:..:|:...:|.|.:|:|.|:||...:|...::........|...:..|.. 
  Fly   140 MSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQLHGY 204

  Fly   219 -PKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVI-----YKNTLHCWATIAK 277
             .:..|::::.|:...:.|  .:.|.|.|..:.|:...      :||     |..|:.....:.|
  Fly   205 LSEGIPLHLTAALVSGLLT--SVTSMPLDMAKTRIQQM------KVIDGKPEYSGTIDVLKKVLK 261

  Fly   278 QEGTGAFFKGAFSNILR-GTGGAFVLVLYDEIKK 310
            .||..|.:||....::| |....|..|..:::.|
  Fly   262 NEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 22/88 (25%)
PTZ00169 23..312 CDD:240302 67/294 (23%)
Mito_carr 124..220 CDD:278578 20/99 (20%)
Mito_carr 223..312 CDD:278578 22/94 (23%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 25/97 (26%)
PTZ00169 18..296 CDD:240302 67/294 (23%)
Mito_carr 109..205 CDD:278578 20/95 (21%)
Mito_carr 208..300 CDD:278578 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.