DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and Tyler

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:338 Identity:65/338 - (19%)
Similarity:121/338 - (35%) Gaps:103/338 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GGISAAVSKTAVAPIERVKLLLQVQHISKQ--------------------ISPD----------- 63
            ||:   ::...|.|:|.||..:|.||..:|                    .|.|           
  Fly    55 GGL---ITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQ 116

  Fly    64 --KQYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFA----FKDKYKQVFL------- 115
              :..:|.:|.|::|....|||..|.|....::...|:..:.|.    .|:....::|       
  Fly   117 NLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEE 181

  Fly   116 -----------GG--VDK-------------NTQFWRYFAGNLASGGAAGATSLCFVYPLDFART 154
                       ||  :|:             :|....|:. .:|||..:....:..:.|::..|.
  Fly   182 SGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYV-PMASGICSRTIVVTAITPIEMVRI 245

  Fly   155 RLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDP 219
            ::.::     ...:..|...|..:.:..||:||:||:..:|.....:...|:..|:..:......
  Fly   246 KMQSE-----YMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAFSVT 305

  Fly   220 KNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAF 284
            :.|.:: |:....:...||..|:.|||.:.....::.|:   :|:|:..         ..|||| 
  Fly   306 EPTFLF-SFLTGAISGAVATFVTMPFDLITTHTQIELGQ---DVLYEEI---------GAGTGA- 356

  Fly   285 FKGAFSNILRGTG 297
                      |||
  Fly   357 ----------GTG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 26/140 (19%)
PTZ00169 23..312 CDD:240302 65/338 (19%)
Mito_carr 124..220 CDD:278578 17/95 (18%)
Mito_carr 223..312 CDD:278578 17/75 (23%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 25/118 (21%)
Mito_carr 216..302 CDD:278578 17/91 (19%)
Mito_carr 306..429 CDD:278578 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.