DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and Mpcp1

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:294 Identity:68/294 - (23%)
Similarity:109/294 - (37%) Gaps:36/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVI 94
            |.||...:.|.|.|::.||..|||       .|.| ||.:...|.....|:|.....:|.....|
  Fly    82 GIISCGSTHTMVVPLDLVKCRLQV-------DPAK-YKSVFTGFRISLAEEGVRGLAKGWAPTFI 138

  Fly    95 RYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD 159
            .|.......|...:.:|:|:...:.:...|.......||:..:|...:...:.|::.|:.::...
  Fly   139 GYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTT 203

  Fly   160 TGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGML-----PDP 219
            .|..     ..|...|.|:...:|:...|:|........|.|....|..::....:|     |.|
  Fly   204 PGFA-----KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKP 263

  Fly   220 -----KNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQE 279
                 |...:.:::|...:......|||:|.|||..::....|..|.:|            |||.
  Fly   264 RADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDV------------AKQL 316

  Fly   280 GTGAFFKGAFSNILR-GTGGAFVLVLYDEIKKVL 312
            |....:.|....|:. ||..|....:||.:|..|
  Fly   317 GWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVFL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 24/85 (28%)
PTZ00169 23..312 CDD:240302 67/292 (23%)
Mito_carr 124..220 CDD:278578 19/105 (18%)
Mito_carr 223..312 CDD:278578 23/89 (26%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 24/85 (28%)
Mito_carr <188..258 CDD:278578 13/74 (18%)
Mito_carr 273..350 CDD:278578 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.