DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and CG8323

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:305 Identity:70/305 - (22%)
Similarity:130/305 - (42%) Gaps:32/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DFAAGGISAAVSKTAVAPIERVKLLLQVQ-HISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGN 89
            ||..||:::..:.....|||.:|..:|:| .::.:.:..:.|||:|:.||.:.|..|.:...:| 
  Fly     5 DFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKG- 68

  Fly    90 LANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRY-------FAGNLASGGAAGATSLCFVY 147
            ||..: ||     .|........::...:::.   |.:       :...|..|...|.....|..
  Fly    69 LAPAL-YF-----QFIINSFRLSIYSEAMERR---WMHNRKGEVSYGMGLLWGAIGGVVGCYFSS 124

  Fly   148 PLDFARTRLAADTGK----GGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGF 208
            |....:|:|.:...|    |.|...|.:.:.|.:|:..:|:.||:||...::....:...|....
  Fly   125 PFFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIAT 189

  Fly   209 YDTARGMLP--DPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQ----SGRKATEVIYKN 267
            :...:.:|.  |....|...|::...:..::..:...|.|.:..|:..|    .||   .::|:.
  Fly   190 FGKTKALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGR---GLLYRG 251

  Fly   268 TLHCWATIAKQEGTGAFFKGAFSNILR-GTGGAFVLVLYDEIKKV 311
            .|.|:..|.:.||....:||.::|.|| ......||:.:||:..|
  Fly   252 WLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 24/90 (27%)
PTZ00169 23..312 CDD:240302 70/305 (23%)
Mito_carr 124..220 CDD:278578 22/108 (20%)
Mito_carr 223..312 CDD:278578 24/94 (26%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 24/88 (27%)
PTZ00169 5..293 CDD:240302 68/300 (23%)
Mito_carr 101..200 CDD:278578 20/98 (20%)
Mito_carr 206..301 CDD:278578 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.