DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and Rim2

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:353 Identity:71/353 - (20%)
Similarity:134/353 - (37%) Gaps:84/353 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AGGISAAVSKTAVAPIERVKLLLQVQHI--------------------SKQISPDKQYK------ 67
            |||.:..|......|:|.||..||....                    |:.:.|:::.|      
  Fly    14 AGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTIL 78

  Fly    68 -------------------------------GMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQA 101
                                           .:|.|...|.:.:|..:.::|...|::...|::|
  Fly    79 RNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSRA 143

  Fly   102 LNFAFKDKYKQVF--LGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADTGKGG 164
            :.|....:.|...  ||.|::::..     .::.|..:||..|.....|:.|.:||:..|.....
  Fly   144 IYFCTYSQTKNTLNSLGFVERDSPL-----VHIMSAASAGFVSSTATNPIWFVKTRMQLDYNSKV 203

  Fly   165 QREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGML--------PDPKN 221
            |..   :..|:.:::...|:...|:|...|..| |.....:|..|:..:..|        .|.|.
  Fly   204 QMT---VRQCIERVYAQGGVAAFYKGITASYFG-ICETMVHFVIYEFIKSKLLEQRNQRHTDTKG 264

  Fly   222 TPIYISWAIAQVVT-TVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFF 285
            :..::.:.:|..|: |:|..::||.:..|.| :.:.|.|...  :..|||   |:.|:||....:
  Fly   265 SRDFLEFMMAGAVSKTIASCIAYPHEVARTR-LREEGNKYNS--FWQTLH---TVWKEEGRAGLY 323

  Fly   286 KGAFSNILRG-TGGAFVLVLYDEIKKVL 312
            :|..:.::|. ...|.::..|:.:..||
  Fly   324 RGLATQLVRQIPNTAIMMATYEAVVYVL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 23/145 (16%)
PTZ00169 23..312 CDD:240302 69/351 (20%)
Mito_carr 124..220 CDD:278578 21/103 (20%)
Mito_carr 223..312 CDD:278578 21/90 (23%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 23/141 (16%)
Mito_carr 163..253 CDD:278578 20/98 (20%)
Mito_carr 268..355 CDD:278578 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.