DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and Ucp4A

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:313 Identity:73/313 - (23%)
Similarity:133/313 - (42%) Gaps:29/313 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FD-AVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDK---QYKGMVDCFIRIPK 78
            || |..|...:....::|::::.|..|::..|..||:|......|..|   ||:|||.....|.:
  Fly    34 FDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAR 98

  Fly    79 EQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSL 143
            |:|....|:|....:.|:.....:.....|..::.|.....:....|:    :...|..|||.:.
  Fly    99 EEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWK----SALCGVTAGAVAQ 159

  Fly   144 CFVYPLDFARTRLAADTGKGGQREFTG-------LGNCLTKIFKSDGIVGLYRGFGVSVQGIIIY 201
            ....|.|..:.::..:    |:|...|       .|:...:|.:..||.||::|...:||...:.
  Fly   160 WLASPADLVKVQIQME----GRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALV 220

  Fly   202 RAAYFGFYDTARGMLPDPKNTP-IYISWAIAQVVT-TVAGIVSYPFDTVRRRMMMQ----SGRKA 260
            .......|||.:.::.:....| .:....:|.|.. .||.|:..|.|.|:.|:|.|    :||  
  Fly   221 NLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGR-- 283

  Fly   261 TEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVL-YDEIKKVL 312
             .::|:.::.|......:||..|.:||.....:|....:....| :::|:|::
  Fly   284 -GLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 25/100 (25%)
PTZ00169 23..312 CDD:240302 70/305 (23%)
Mito_carr 124..220 CDD:278578 22/102 (22%)
Mito_carr 223..312 CDD:278578 25/95 (26%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 70/306 (23%)
Mito_carr 39..138 CDD:278578 23/98 (23%)
Mito_carr 142..239 CDD:278578 22/104 (21%)
Mito_carr 248..336 CDD:278578 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441695
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.