DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and CG1628

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:333 Identity:77/333 - (23%)
Similarity:139/333 - (41%) Gaps:73/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKE 79
            |.:.:.|..:.||.||.:..|.......|::.||:.||.       .|: .|:||:|||:...::
  Fly   161 GNNINFVEGLIDFLAGSLGGAAQVYVSQPLDTVKVKLQT-------FPE-AYRGMLDCFLSTYRK 217

  Fly    80 QG-FSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQF--WRYFAGNLAS--GGAAG 139
            .| ....:.|::..|.......::.||        ..||..|...|  .:..||:|.:  ...||
  Fly   218 DGVLRGLYAGSVPAVFANVAENSVLFA--------AYGGCQKFVAFCVGKETAGDLTTVQNACAG 274

  Fly   140 ATSLCF----VYPLDFARTRLAADTGKGGQREFTGLGN-----------CLTK-IFKSDGIVGLY 188
            :.:.||    :.|.:..:.:|.|      .||......           .||: |::::||.|.|
  Fly   275 SLAACFSTLTLCPTELIKCKLQA------LREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFY 333

  Fly   189 RG----FGVSVQGIIIYRAAYFGFYDTARGML-PDPKNTPIYISWAIAQVVTTVAGIV------- 241
            ||    |...:.|...    :||.|:..|.:| .|.::..     .|..:.|.:||.:       
  Fly   334 RGLSSTFLREMPGYFF----FFGSYEGTRELLRRDDQSKD-----DIGPLRTMIAGAIGGVCLWT 389

  Fly   242 -SYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRG-TGGAFVLVL 304
             ::|.|.::.|:.:::       :.::.....|.|.::||..|.::|...::||. ...|.:.|:
  Fly   390 STFPADVIKSRIQVKN-------LNESMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVV 447

  Fly   305 YDEIKKVL 312
            |:..|:.|
  Fly   448 YEYTKRAL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 23/97 (24%)
PTZ00169 23..312 CDD:240302 74/323 (23%)
Mito_carr 124..220 CDD:278578 30/120 (25%)
Mito_carr 223..312 CDD:278578 19/97 (20%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 75/330 (23%)
Mito_carr 170..252 CDD:278578 24/97 (25%)
Mito_carr 263..364 CDD:278578 27/110 (25%)
Mito_carr 369..455 CDD:278578 19/97 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.