DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and SLC25A5

DIOPT Version :10

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001143.2 Gene:SLC25A5 / 292 HGNCID:10991 Length:298 Species:Homo sapiens


Alignment Length:117 Identity:22/117 - (18%)
Similarity:44/117 - (37%) Gaps:39/117 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EEFMSLPEL--QQNPLVQRVID---IFDEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYD 100
            |.:|::.|.  :.:|.|:..::   |..|:...:|:..:  |.|.|||             :.:|
Human    72 EPWMAVKEETDRPSPDVETCVEAENISPENHMSDVNLHK--QSIRQFS-------------KTFD 121

  Fly   101 MDRDGFISNGELFQVLKMMVGNNLKDSQLQQIVDKTILFHDKDGDGKISFQE 152
            :....| |:|......|.:.|                  :..|.|.:::.:|
Human   122 LKESTF-SDGPSCSTFKGLQG------------------YQGDADERVTKKE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 PTZ00169 23..312 CDD:240302 22/117 (19%)
SLC25A5NP_001143.2 Solcar 1 6..98 5/25 (20%)
PTZ00169 7..296 CDD:240302 22/117 (19%)
Solcar 2 111..201 14/76 (18%)
Solcar 3 212..297
Important for transport activity. /evidence=ECO:0000250|UniProtKB:P12235 235..240
Nucleotide carrier signature motif. /evidence=ECO:0000250|UniProtKB:P02722 235..240
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.