DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and F25B4.7

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_504498.2 Gene:F25B4.7 / 184917 WormBaseID:WBGene00017770 Length:306 Species:Caenorhabditis elegans


Alignment Length:296 Identity:146/296 - (49%)
Similarity:201/296 - (67%) Gaps:5/296 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFS 83
            |.:.|.|||.||..:||:|||.:||:|||||:||:|:....::.:.:|||:||||||:|:||||.
 Worm    14 DVIKFSKDFMAGATAAAISKTVIAPVERVKLILQLQNSQTTLALENRYKGIVDCFIRVPREQGFL 78

  Fly    84 SFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYP 148
            ||||||..|::|....::|..:||:.:::..|.|||..||..|:..|||.:||.:|..:|..:||
 Worm    79 SFWRGNWVNILRSCSQESLGLSFKEFFRKYSLEGVDPKTQHSRWLVGNLVAGGGSGCATLATIYP 143

  Fly   149 LDFARTRLAADTGK-GGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYD-T 211
            |||.|||||.|.|| ...|||||:.:|..||.||||:.|||:|...|:|.:||||.||:|.:| |
 Worm   144 LDFIRTRLAIDLGKRKSDREFTGMFDCAKKIIKSDGVPGLYKGLIPSLQYMIIYRGAYYGLFDTT 208

  Fly   212 ARGMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIA 276
            |..|..|.|.| ...::.:.||||.:|.:.|||.||||||:||.:|:|.  :.:.||:.|...|.
 Worm   209 APYMNSDGKMT-FTEAFLVGQVVTLIAAMTSYPLDTVRRRLMMGAGKKT--LPFNNTISCIKYIY 270

  Fly   277 KQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKVL 312
            .:||..|||.||..|.:||||.|.||.:|:|::|.:
 Worm   271 TKEGPKAFFHGALVNAIRGTGAALVLAIYNELQKYM 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 47/96 (49%)
PTZ00169 23..312 CDD:240302 145/290 (50%)
Mito_carr 124..220 CDD:278578 51/97 (53%)
Mito_carr 223..312 CDD:278578 40/88 (45%)
F25B4.7NP_504498.2 Mito_carr 14..108 CDD:278578 47/93 (51%)
PTZ00169 18..306 CDD:240302 145/290 (50%)
Mito_carr 123..208 CDD:278578 46/84 (55%)
Mito_carr 216..306 CDD:278578 42/92 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0749
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D440386at33208
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45635
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.