DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sesB and Slc25a5

DIOPT Version :9

Sequence 1:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_031477.1 Gene:Slc25a5 / 11740 MGIID:1353496 Length:298 Species:Mus musculus


Alignment Length:292 Identity:239/292 - (81%)
Similarity:261/292 - (89%) Gaps:1/292 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSS 84
            ||.|.|||.|||::||:|||||||||||||||||||.||||:.||||||::||.:|||||||..|
Mouse     5 AVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLS 69

  Fly    85 FWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPL 149
            ||||||||||||||||||||||||||||:|||||||.||||||||||||||||||||||||||||
Mouse    70 FWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPL 134

  Fly   150 DFARTRLAADTGK-GGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTAR 213
            ||||||||||.|| |.:|||.|||:||.||:|||||.|||:||.|||||||||||||||.||||:
Mouse   135 DFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK 199

  Fly   214 GMLPDPKNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQ 278
            |||||||||.|:|||.|||.||.|||:.||||||||||||||||||.|:::|..||.||..||:.
Mouse   200 GMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARD 264

  Fly   279 EGTGAFFKGAFSNILRGTGGAFVLVLYDEIKK 310
            ||:.||||||:||:|||.||||||||||||||
Mouse   265 EGSKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 79/95 (83%)
PTZ00169 23..312 CDD:240302 237/289 (82%)
Mito_carr 124..220 CDD:278578 83/96 (86%)
Mito_carr 223..312 CDD:278578 65/88 (74%)
Slc25a5NP_031477.1 Solcar 1 6..98 76/91 (84%)
PTZ00169 7..296 CDD:240302 235/288 (82%)
Solcar 2 111..201 76/89 (85%)
Solcar 3 212..297 64/85 (75%)
Important for transport activity. /evidence=ECO:0000250|UniProtKB:P12235 235..240 4/4 (100%)
Nucleotide carrier signature motif. /evidence=ECO:0000250|UniProtKB:P02722 235..240 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3760
eggNOG 1 0.900 - - E1_KOG0749
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 493 1.000 Inparanoid score I1386
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54049
OrthoDB 1 1.010 - - D440386at33208
OrthoFinder 1 1.000 - - FOG0000386
OrthoInspector 1 1.000 - - otm43708
orthoMCL 1 0.900 - - OOG6_100505
Panther 1 1.100 - - O PTHR45635
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R28
SonicParanoid 1 1.000 - - X286
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.