DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and cmtm8b

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001074114.1 Gene:cmtm8b / 791163 ZFINID:ZDB-GENE-070112-1312 Length:178 Species:Danio rerio


Alignment Length:139 Identity:31/139 - (22%)
Similarity:55/139 - (39%) Gaps:30/139 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DYFRTIPGIIKIVEFVLGIICMALA-------APPLASATSFFMFVIVISFIINILLIAAYFLGI 99
            ::.|:..|::.:.|.|.|:....|.       .|    |..:.|||.|..:::.::|...|.:  
Zfish    38 NFIRSASGVLMVGEIVFGLFVWTLIGGTEYLHVP----ALRWVMFVSVFYWVLTVILFLLYLI-- 96

  Fly   100 REALNVAVNWIFSELITTAV---LTLLYFIGFIVQLARWSDATGKGSGSNTAAGVFGLFNFLAYA 161
              .|::.:.||...::....   .|:||.           .|...|:.|...|. .|.:.|:.:.
Zfish    97 --TLHIRITWIPWNILGMCFHGSATVLYL-----------SAAVMGTLSLNVAN-RGRYYFICWV 147

  Fly   162 AGTYFLFLA 170
            |.|.|..||
Zfish   148 ASTIFASLA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 28/132 (21%)
cmtm8bNP_001074114.1 MARVEL 39..166 CDD:279608 31/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455336at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.