DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and mala.2

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001070931.1 Gene:mala.2 / 768299 ZFINID:ZDB-GENE-061027-365 Length:154 Species:Danio rerio


Alignment Length:174 Identity:40/174 - (22%)
Similarity:57/174 - (32%) Gaps:75/174 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TTTTTNG--PPGGANPTVGSGGGFWSAIRLNIDYFRTIPGIIKIVEFVLGIICMALAAP------ 68
            |.|...|  |.|||                   .|.|||.|:.:.|.:.|.:.:||.|.      
Zfish     3 TNTGQMGFLPSGGA-------------------IFCTIPDILYLPELIFGGLTLALVASTYLIPY 48

  Fly    69 -PLASATSFFMFVIVISF--------------------------IINIL------LIAAYFLGIR 100
             |.|...|..:|..::||                          ...:|      |:|...:||.
Zfish    49 NPQAYVISVTIFCFIVSFFWLMVFACGSHRNKSSWASADVAYHGFATVLYPSASVLLALVTIGIA 113

  Fly   101 E---------ALNVAVNWIFSELITTAVLTLLYFIGFIVQLARW 135
            :         .|:||.      ::.:.:.||||||..|....||
Zfish   114 QIQTETTLIYQLDVAA------VVFSFLTTLLYFIHTIFSAIRW 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 33/141 (23%)
mala.2NP_001070931.1 MARVEL 18..146 CDD:279608 30/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.