powered by:
Protein Alignment CG15211 and Cmtm2b
DIOPT Version :9
Sequence 1: | NP_001096945.1 |
Gene: | CG15211 / 32006 |
FlyBaseID: | FBgn0030234 |
Length: | 177 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_082800.1 |
Gene: | Cmtm2b / 75502 |
MGIID: | 2447311 |
Length: | 210 |
Species: | Mus musculus |
Alignment Length: | 48 |
Identity: | 17/48 - (35%) |
Similarity: | 23/48 - (47%) |
Gaps: | 5/48 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 IINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIVQLA 133
:|.||||||.....|.|.:..| .|:.|..|::..|..|:..||
Mouse 46 LIMILLIAAMVCFQRVATHPIV-----ILLLTMELSICAFFFFLYSLA 88
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15211 | NP_001096945.1 |
MARVEL |
43..166 |
CDD:279608 |
17/48 (35%) |
Cmtm2b | NP_082800.1 |
MARVEL |
35..>120 |
CDD:279608 |
17/48 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4788 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.