DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15211 and Cmtm2b

DIOPT Version :9

Sequence 1:NP_001096945.1 Gene:CG15211 / 32006 FlyBaseID:FBgn0030234 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_082800.1 Gene:Cmtm2b / 75502 MGIID:2447311 Length:210 Species:Mus musculus


Alignment Length:48 Identity:17/48 - (35%)
Similarity:23/48 - (47%) Gaps:5/48 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 IINILLIAAYFLGIREALNVAVNWIFSELITTAVLTLLYFIGFIVQLA 133
            :|.||||||.....|.|.:..|     .|:.|..|::..|..|:..||
Mouse    46 LIMILLIAAMVCFQRVATHPIV-----ILLLTMELSICAFFFFLYSLA 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15211NP_001096945.1 MARVEL 43..166 CDD:279608 17/48 (35%)
Cmtm2bNP_082800.1 MARVEL 35..>120 CDD:279608 17/48 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4788
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.